Podoplanin Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13261
Zusätzliche Namen:: AGGRUS|D2-40|GP36|Gp38|GP40|HT1A-1|OTS8|PA2.26|Podoplanin|T1A|T1A-2|T1A2|TI1A
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 36kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTL
Uniprot:: Q86YL7
Synonyme:: AGGRUS;glycoprotein 36;glycoprotein, 36-KD;GP36;Gp38;GP40;HT1A-1;hT1alpha-1;hT1alpha-2;lung type I cell membrane associated glycoprotein;lung type-I cell membrane-associated glycoprotein (T1A-2);OTS8;PA2.26;PA2.26 antigen;podoplanin;T1-alpha;T1A;T1A-2;T1A2;TI1A
Weitere Details:: This gene encodes a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury. Alternatively spliced transcript variants encoding different isoforms have been identified.