SREK1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13235
Zusätzliche Namen:: SFRS12|SREK1|SRrp508|SRrp86
Anwendung:: ELISA, WB
Molekulargewicht:: 59kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MTSLMPGAGLLPIPTPNPLTTLGVSLSSLGAIPAAALDPNIATLGEIPQPPLMGNVDPSKIDEIRRTVYVGNLNSQTTTADQLLEFFKQVGEVKFVRMAGDETQPTRFAFVEFADQNSVPRALAFNGVMFGDRPLKINHSNNAIVKPPEMTPQAAAKELEEVMKRVREAQSFISAAIEPE
Uniprot:: Q8WXA9
Synonyme:: serine-arginine-rich splicing regulatory protein 508;serine/arginine-rich-splicing regulatory protein 86;SFRS12;splicing factor, arginine/serine-rich 12;splicing regulatory glutamic acid/lysine-rich protein 1;splicing regulatory glutamine/lysine-rich protein 1;Splicing regulatory protein 508;SRrp508;SRrp86
Weitere Details:: This gene encodes a member of a family of serine/arginine-rich (SR) splicing proteins containing RNA recognition motif (RRM) domains. The encoded protein interacts with other SR proteins to modulate splice site selection. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.