A13233
GTF3C6 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A13233
- Zusätzliche Namen:
- bA397G5.3|C6orf51|GTF3C6|TFIIIC35
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 24kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAAAADERSPEDGEDEEEEEQLVLVELSGIIDSDFLSKCENKCKVLGIDTERPILQVDSCVFAGEYEDTLGTCVIFEENVEHADTEGNNKTVLKYKCHTMKKLSMTRTLLTEKKEGEENIGGVEWLQIKDNDFSYRPNMICNFLHENEDEEVVASAPDKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP
- Uniprot:
- Q969F1
- Synonyme:
- bA397G5.3;C6orf51;general transcription factor 3C polypeptide 6;general transcription factor IIIC, polypeptide 6, alpha 35kDa;TFIIIC 35 kDa subunit;TFIIIC35;transcription factor IIIC 35 kDa subunit;transcription factor IIIC 35kDa;transcription factor IIIC subunit 6
- Weitere Details:
- RNA polymerases are unable to initiate RNA synthesis in the absence of additional proteins called general transcription factors (GTFs). GTFs assemble in a complex on the DNA promoter and recruit the RNA polymerase. GTF3C family proteins (e.g., GTF3C1, MIM 603246) are essential for RNA polymerase III to make a number of small nuclear and cytoplasmic RNAs, including 5S RNA (MIM 180420), tRNA, and adenovirus-associated (VA) RNA of both cellular and viral origin.
- Versandbedingungen:
- Blue Ice