A1321
PON1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A1321
- Zusätzliche Namen:
- ESA|MVCD5|PON|PON1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 52kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LLGMGLALFRNHQSSYQTRLNALREVQPVELPNCNLVKGIETGSEDLEILPNGLAFISSGLKYPGIKSFNPNSPGKILLMDLNEEDPTVLELGITGSKFDV
- Uniprot:
- P27169
- Synonyme:
- A-esterase 1;aromatic esterase 1;arylesterase 1;arylesterase B-type;ESA;esterase A;K-45;MVCD5;paraoxonase B-type;PON;PON 1;serum aryldiakylphosphatase;serum aryldialkylphosphatase 1;serum paraoxonase/arylesterase 1
- Weitere Details:
- This gene encodes a member of the paraoxonase family of enzymes and exhibits lactonase and ester hydrolase activity. Following synthesis in the kidney and liver, the enzyme is secreted into the circulation, where it binds to high density lipoprotein (HDL) particles and hydrolyzes thiolactones and xenobiotics, including paraoxon, a metabolite of the insecticide parathion. Polymorphisms in this gene may be associated with coronary artery disease and diabetic retinopathy. The gene is found in a cluster of three related paraoxonase genes on chromosome 7.
- Versandbedingungen:
- Blue Ice

