LSM3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13189
Zusätzliche Namen:: LSM3|SMX4|USS2|YLR438C
Anwendung:: ELISA, WB
Molekulargewicht:: 12kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG
Uniprot:: P62310
Synonyme:: LSM3 homolog, U6 small nuclear RNA associated;LSM3 U6 small nuclear RNA and mRNA degradation associated;SMX4;U6 snRNA-associated Sm-like protein LSm3;USS2;YLR438C
Weitere Details:: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.