TDO2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13182
Zusätzliche Namen:: HYPTRP|TDO|TDO2|TO|TPH2|TRPO
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 48kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYR
Uniprot:: P48775
Synonyme:: HYPTRP;TDO;TO;TPH2;TRPO;tryptamin 2,3-dioxygenase;tryptophan 2,3-dioxygenase;tryptophan oxygenase;tryptophan pyrrolase;tryptophanase
Weitere Details:: This gene encodes a heme enzyme that plays a critical role in tryptophan metabolism by catalyzing the first and rate-limiting step of the kynurenine pathway. Increased activity of the encoded protein and subsequent kynurenine production may also play a role in cancer through the suppression of antitumor immune responses, and single nucleotide polymorphisms in this gene may be associated with autism.