A13180
KLF10 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A13180
- Zusätzliche Namen:
- EGR-alpha|EGRA|KLF10|TIEG|TIEG1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 56kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVDEKASAALYDFSVPSSETVICRSQPAPVSPQQKSVLVSPPAVSAGGVPPMPVICQMVPLPANNPVVTTVVPSTPPSQPPAVCPPVVFMGTQVPKGAVMFVVPQPVVQSSKPPVVSPNGTRLSPIAPAPGFSPSAAKVTPQIDSSRIRSHICSHPGC
- Uniprot:
- Q13118
- Synonyme:
- early growth response-alpha;EGR-alpha;EGRA;Krueppel-like factor 10;TGFB-inducible early growth response protein 1;TIEG;TIEG1;transforming growth factor-beta-inducible early growth response protein 1;zinc finger transcription factor TIEG
- Weitere Details:
- This gene encodes a member of a family of proteins that feature C2H2-type zinc finger domains. The encoded protein is a transcriptional repressor that acts as an effector of transforming growth factor beta signaling. Activity of this protein may inhibit the growth of cancers, particularly pancreatic cancer. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice

