Rubicon Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13169
Zusätzliche Namen:: KIAA0226|RUBICON|SCAR15
Anwendung:: ELISA, WB
Molekulargewicht:: 108kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MRPEGAGMELGGGEERLPEESRREHWQLLGNLKTTVEGLVSTNSPNVWSKYGGLERLCRDMQSILYHGLIRDQACRRQTDYWQFVKDIRWLSPHSALHVEKFISVHENDQSSADGASERAVAELWLQHSLQYHCLSAQLRPLLGDRQYIRKFYTDAAFLLSDAHVTAMLQCLEAVEQNNPRLLAQIDASMFARKHESPLL
Uniprot:: Q92622
Synonyme:: baron;beclin-1 associated RUN domain containing protein;KIAA0226;RUBICON;RUN and cysteine rich domain containing beclin 1 interacting protein;RUN domain and cysteine-rich domain containing, Beclin 1-interacting protein;run domain Beclin-1-interacting and cysteine-rich domain-containing protein;rundataxin;SCAR15
Weitere Details:: The protein encoded by this gene is a negative regulator of autophagy and endocytic trafficking and controls endosome maturation. This protein contains two conserved domains, an N-terminal RUN domain and a C-terminal DUF4206 domain. The RUN domain is involved in Ras-like GTPase signaling, and the DUF4206 domain contains a diacylglycerol (DAG) binding-like motif. Mutation in this gene results in deletion of the DAG binding-like motif and causes a recessive ataxia. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Versandbedingungen:: Blue Ice