A13166
U2AF1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A13166
- Zusätzliche Namen:
- FP793|RN|RNU2AF1|U2AF1|U2AF35|U2AFBP
- Anwendung:
- ELISA, WB, IHC-P, IP
- Molekulargewicht:
- 38kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQSADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMN
- Uniprot:
- Q01081
- Synonyme:
- FP793;RN;RNU2AF1;splicing factor U2AF 35 kDa subunit;splicing factor U2AF 35 kDa subunit-like protein;splicing factor U2AF 35kDa subunit;U2 auxiliary factor 35 kDa subunit;U2 small nuclear ribonucleoprotein auxillary factor, 35-KD subunit;U2 small nuclear RNA auxiliary factor 1;U2 small nuclear RNA auxiliary factor 1-like protein 5;U2 small nuclear RNA auxillary factor 1;U2 snRNP auxiliary factor small subunit;U2(RNU2) small nuclear RNA auxiliary factor binding protein;U2AF1L5;U2AF35;U2AFBP
- Weitere Details:
- This gene belongs to the splicing factor SR family of genes. U2 auxiliary factor, comprising a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the small subunit which plays a critical role in both constitutive and enhancer-dependent RNA splicing by directly mediating interactions between the large subunit and proteins bound to the enhancers. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Versandbedingungen:
- Blue Ice





