IL-1 alpha Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1316
Zusätzliche Namen:: IL-1 alpha|IL-1A|IL1|IL1-ALPHA|IL1F1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 31 kDa/21 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQIL
Uniprot:: P01583
Synonyme:: hematopoietin-1;IL-1 alpha;IL-1A;IL1;IL1-ALPHA;IL1F1;interleukin-1 alpha;preinterleukin 1 alpha;pro-interleukin-1-alpha
Weitere Details:: The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease.