PRDM2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13157
Zusätzliche Namen:: HUMHOXY1|KMT8|KMT8A|MTB-ZF|PRDM2|RIZ|RIZ1|RIZ2
Anwendung:: ELISA, WB
Molekulargewicht:: 300kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MNQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYNGEDNPEIAAAIEEERASARSKRSSPKSRKGKKKSQ
Uniprot:: Q13029
Synonyme:: GATA-3 binding protein G3B;GATA-3-binding protein G3B;HUMHOXY1;KMT8;KMT8A;lysine N-methyltransferase 8;MTB-ZF;MTE-binding protein;PR domain 2;PR domain containing 2, with ZNF domain;PR domain zinc finger protein 2;PR domain-containing protein 2;retinoblastoma protein-binding zinc finger protein;retinoblastoma protein-interacting zinc finger protein;RIZ;RIZ1;RIZ2;zinc finger protein RIZ;zinc-finger DNA-binding protein
Weitere Details:: This tumor suppressor gene is a member of a nuclear histone/protein methyltransferase superfamily. It encodes a zinc finger protein that can bind to retinoblastoma protein, estrogen receptor, and the TPA-responsive element (MTE) of the heme-oxygenase-1 gene. Although the functions of this protein have not been fully characterized, it may (1) play a role in transcriptional regulation during neuronal differentiation and pathogenesis of retinoblastoma, (2) act as a transcriptional activator of the heme-oxygenase-1 gene, and (3) be a specific effector of estrogen action. Multiple transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice