CHCHD4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13139
Zusätzliche Namen:: CHCHD4|MIA40|TIMM40
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 16kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS
Uniprot:: Q8N4Q1
Synonyme:: coiled-coil-helix-coiled-coil-helix domain-containing protein 4;MIA40;mitochondrial intermembrane space import and assembly protein 40;TIMM40;translocase of inner mitochondrial membrane 40 homolog
Weitere Details:: CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus (Hofmann et al., 2005 [PubMed 16185709]).