SCGB3A2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13137
Zusätzliche Namen:: LU103|pnSP-1|PNSP1|SCGB3A2|UGRP1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 14kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MKLVTIFLLVTISLCSYSATAFLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV
Uniprot:: Q96PL1
Synonyme:: LU103;pneumo secretory protein 1;pnSP-1;PNSP1;secretoglobin family 3A member 2;UGRP1;uteroglobin-related protein 1
Weitere Details:: The protein encoded by this gene is a secreted lung surfactant protein and a downstream target of thyroid transcription factor. A single nucleotide polymorphism in the promoter of this gene results in susceptibility to asthma.