RBM26 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13120
Zusätzliche Namen:: ARRS2|C13orf10|PPP1R132|PRO1777|RBM26|SE70-2|ZC3H17
Anwendung:: ELISA, WB
Molekulargewicht:: 113kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TQIFVEKLFDAVNTKSYLPPPEQPSSGSLKVEFFPHQEKDIKKEEITKEEEREKKFSRRLNHSPPQSSSRYRENRS
Uniprot:: Q5T8P6
Synonyme:: acidic rich RS domain containing 2;ARRS2;C13orf10;CTCL tumor antigen se70-2;cutaneous T-cell lymphoma tumor antigen se70-2;PPP1R132;PRO1777;protein phosphatase 1, regulatory 132;RNA-binding motif protein 26;RNA-binding protein 26;SE70-2;ZC3H17
Weitere Details:: Enables RNA binding activity. Predicted to be involved in mRNA processing. Predicted to be active in nucleus.