TSPYL2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13118
Zusätzliche Namen:: CDA1|CINAP|CTCL|DENTT|HRIHFB2216|NP79|SE204|TSPX|TSPYL2
Anwendung:: ELISA, WB
Molekulargewicht:: 110kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LKRKFIQMRRPFLERRDLIIQHIPGFWVKAFLNHPRISILINRRDEDIFRYLTNLQVQDLRHISMGYKMKLYFQTNPYFTNMVIVKEFQRNRSGRLVSHSTPIRWHRGQEPQARRHGNQDASHSFFSWFSNHSLPEADRIAEIIKNDLWVNPLRYYLRERGSRIKRKKQEMKKRKTRGRCEVVIMEDAPDYYAVEDIFSEISDIDETIHDIKISDFMETTD
Uniprot:: Q9H2G4
Synonyme:: CASK-interacting nucleosome assembly protein;CDA1;cell division autoantigen 1;CINAP;CTCL;CTCL tumor antigen se20-4;CTCL-associated antigen se20-4;cutaneous T-cell lymphoma-associated antigen se20-4;cutaneous T-cell lymphoma-associated tumor antigen se20-4;DENTT;differentially expressed nucleolar TGF-beta1 target;differentially-expressed nucleolar TGF-beta1 target protein;HRIHFB2216;NP79;nuclear protein of 79 kDa;SE204;testis-specific protein Y encoded-like 2;testis-specific Y-encoded-like protein 2;TSPX;TSPY-like protein 2
Weitere Details:: This gene encodes a member of the testis-specific protein Y-encoded, TSPY-like/SET/nucleosome assembly protein-1 superfamily. The encoded protein is localized to the nucleolus where it functions in chromatin remodeling and as an inhibitor of cell-cycle progression. This protein may play a role in the suppression of tumor growth.

Versandbedingungen:: Blue Ice