YY1AP1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13104
Zusätzliche Namen:: GRNG|HCCA1|HCCA2|YY1AP|YY1AP1
Anwendung:: ELISA, WB
Molekulargewicht:: 88kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MGFSNMEDDGPEEEERVAEPQANFNTPQALRFEELLANLLNEQHQIAKELFEQLKMKKPSAKQQKEVEKVKPQCKEVHQT
Uniprot:: Q9H869
Synonyme:: GRNG;HCCA1;HCCA2;hepatocellular carcinoma susceptibility protein;hepatocellular carcinoma-associated protein 2;YY1-associated protein 1;YY1AP
Weitere Details:: Predicted to enable transcription coregulator activity. Involved in cell differentiation; cell population proliferation; and regulation of cell cycle. Located in fibrillar center and nucleoplasm. Colocalizes with Ino80 complex.