SF3B6 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13097
Zusätzliche Namen:: CGI-110|HSPC175|Ht006|P14|SAP14|SAP14a|SF3B14|SF3B14a|SF3B6
Anwendung:: ELISA, WB
Molekulargewicht:: 14kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
Uniprot:: Q9Y3B4
Synonyme:: CGI-110;HSPC175;Ht006;P14;pre-mRNA branch site protein p14;SAP14;SAP14a;SF3b 14 kDa subunit;SF3B14;SF3B14a;spliceosome-associated protein, 14 kDa subunit;spliceosome-associated protein, 14-kDa;splicing factor 3B subunit 6;splicing factor 3B, 14 kDa subunit;splicing factor 3b, subunit 6, 14kDa
Weitere Details:: This gene encodes a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. This 14 kDa protein also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site.