A13087
A1CF Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A13087
- Zusätzliche Namen:
- A1CF|ACF|ACF64|ACF65|APOBEC1CF|ASP
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 65kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- APPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYE
- Uniprot:
- Q9NQ94
- Synonyme:
- ACF;ACF64;ACF65;apo-B RNA editing protein;apobec-1 complementation factor (ACF) (ASP);APOBEC-1 stimulating protein;APOBEC1 complementation factor;APOBEC1-stimulating protein;APOBEC1CF;ASP
- Weitere Details:
- Mammalian apolipoprotein B mRNA undergoes site-specific C to U deamination, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene. The gene product has three non-identical RNA recognition motifs and belongs to the hnRNP R family of RNA-binding proteins. It has been proposed that this complementation factor functions as an RNA-binding subunit and docks APOBEC-1 to deaminate the upstream cytidine. Studies suggest that the protein may also be involved in other RNA editing or RNA processing events. Several transcript variants encoding a few different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice