ATP13A2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13083
Zusätzliche Namen:: ATP13A2|CLN12|HSA9947|KRPPD|PARK9|SPG78
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 130kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LWGVRLRLRPCNLAHAETLVIEIRDKEDSSWQLFTVQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEAVSVGQKRVLRYYLFQGQRYIWIETQQAFYQVSLLDHGRSCDDVHRSRHGLSLQDQM
Uniprot:: Q9NQ11
Synonyme:: ATPase 13A2;ATPase type 13A2;cation-transporting ATPase 13A2;CLN12;HSA9947;KRPPD;PARK9;polyamine-transporting ATPase 13A2;probable cation-transporting ATPase 13A2;SPG78
Weitere Details:: This gene encodes a member of the P5 subfamily of ATPases which transports inorganic cations as well as other substrates. Mutations in this gene are associated with Kufor-Rakeb syndrome (KRS), also referred to as Parkinson disease 9. Multiple transcript variants encoding different isoforms have been found for this gene.