[KO Validated] GCN1L1 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A13075
Zusätzliche Namen:: GCN1L|GCN1L1|L1|PRIC295
Anwendung:: ELISA, WB
Molekulargewicht:: 293kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LSAVLQQCLLADVSGIDWMVRHGRSLALSVAVNVAPGRLCAGRYSSDVQEMILSSATADRIPIAVSGVRGMGFLMRHHIETGGGQLPAKLSSLFVKCLQNPSSDIRLVAEKMIWWANKDPLPPLDPQAIKPILKALLDNTKDKNTVVRAYSDQAIVNLLKMRQGEEVFQSLSKILDVASLEVLNEVNRRSLKKLASQADSTEQVDDTILT
Uniprot:: Q92616
Synonyme:: eIF-2-alpha kinase activator GCN1;GCN1 (general control of amino-acid synthesis 1, yeast)-like 1;GCN1 eIF-2-alpha kinase activator homolog;GCN1 general control of amino-acid synthesis 1-like 1;GCN1-like protein 1;GCN1, eIF2 alpha kinase activator homolog;GCN1L;GCN1L1;general control of amino-acid synthesis 1-like protein 1;hsGCN1;peroxisome proliferator activated receptor interacting complex protein;PRIC295;translational activator GCN1
Weitere Details:: Enables RNA binding activity and cadherin binding activity. Predicted to be involved in cellular response to leucine starvation and positive regulation of transcription from RNA polymerase II promoter in response to stress. Located in cytosol.