[KO Validated] IFITM3 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A13070
Zusätzliche Namen:: 1-8U|DSPA2b|IP15|M3
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 15 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
Uniprot:: Q01628
Synonyme:: 1-8U;dispanin subfamily A member 2b;DSPA2b;interferon-induced transmembrane protein 3;interferon-inducible protein 1-8U;IP15
Weitere Details:: Interferon-induced transmembrane (IFITM) proteins are a family of interferon induced antiviral proteins. The family contains five members, including IFITM1, IFITM2 and IFITM3 and belong to the CD225 superfamily. The protein encoded by this gene restricts cellular entry by diverse viral pathogens, such as influenza A virus, Ebola virus and Sars-CoV-2.