IFT88 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13054
Zusätzliche Namen:: D13S1056E|DAF19|hTg737|IFT88|TG737|TTC10
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 95kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GLTYEKLNRLDEALDCFLKLHAILRNSAEVLYQIANIYELMENPSQAIEWLMQVVSVIPTDPQVLSKLGELYDREGDKSQAFQYYYESYRYFPCNIEVIEWLGAYYIDTQFWEKAIQYFERASLIQPTQVKWQLMVASCFRRSGNYQKALDTYKDTHRKFPENVECLRFLVRLCTDLGLKDAQEYARKLKRLEKMKEIREQRIKSGRDGSGGSRGKREGSASGDSGQNYSASSKGERLSARLRALPGTNEPYESSSNKEIDASYVDPLGPQIERPKTAAKKRIDEDDFADEELGDDLLPE
Uniprot:: Q13099
Synonyme:: D13S1056E;DAF19;hTg737;intraflagellar transport 88 homolog;intraflagellar transport protein 88 homolog;polaris homolog;probe hTg737 (polycystic kidney disease, autosomal recessive);recessive polycystic kidney disease protein Tg737 homolog;testicular tissue protein Li 93;tetratricopeptide repeat domain 10;tetratricopeptide repeat protein 10;TG737;TPR repeat protein 10;TTC10
Weitere Details:: This gene encodes a member of the tetratrico peptide repeat (TPR) family. The encoded protein is involved in cilium biogenesis. Mutations of a similar gene in mouse can cause polycystic kidney disease. Several transcript variants encoding distinct isoforms have been identified for this gene.

Versandbedingungen:: Blue Ice