A13047
SORL1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A13047
- Zusätzliche Namen:
- C11orf32|gp250|LR11|LRP9|SORL1|SORLA|SorLA-1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 260kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DSAMNITAYLGNTTDNFFKISNLKMGHNYTFTVQARCLFGNQICGEPAILLYDELGSGADASATQAARSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQSSFTAFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA
- Uniprot:
- Q92673
- Synonyme:
- C11orf32;gp250;LDLR relative with 11 ligand-binding repeats;low-density lipoprotein receptor relative with 11 ligand-binding repeats;LR11;LRP9;mosaic protein LR11;SORLA;SorLA-1;sortilin-related receptor;sortilin-related receptor, L(DLR class) A repeats containing;sorting protein-related receptor containing LDLR class A repeats
- Weitere Details:
- This gene encodes a mosaic protein that belongs to at least two families: the vacuolar protein sorting 10 (VPS10) domain-containing receptor family, and the low density lipoprotein receptor (LDLR) family. The encoded protein also contains fibronectin type III repeats and an epidermal growth factor repeat. The encoded preproprotein is proteolytically processed to generate the mature receptor, which likely plays roles in endocytosis and sorting. Mutations in this gene may be associated with Alzheimer's disease.
- Versandbedingungen:
- Blue Ice