A12999
SLC12A1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A12999
- Zusätzliche Namen:
- BSC|BSC-1|BSC1|CCC2|NKCC2|SLC12A1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 150kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- FGDEAQKRLRISFRPGNQECYDNFLQSGETAKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSAD
- Uniprot:
- Q13621
- Synonyme:
- BSC1;bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2;kidney-specific Na-K-Cl symporter;Na-K-2Cl cotransporter;NKCC2;NKCC2A variant A;solute carrier family 12 (sodium/potassium/chloride transporter), member 1;solute carrier family 12 (sodium/potassium/chloride transporters), member 1;solute carrier family 12 member 1
- Weitere Details:
- This gene encodes a kidney-specific sodium-potassium-chloride cotransporter that is expressed on the luminal membrane of renal epithelial cells of the thick ascending limb of Henle's loop and the macula densa. It plays a key role in concentrating urine and accounts for most of the NaCl resorption. It is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional splice variants have been described but their biological validity in humans has not been experimentally proven.
- Versandbedingungen:
- Blue Ice

