A12962
MARCH8 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A12962
- Zusätzliche Namen:
- c-MIR|CMIR|MARCH-VIII|MARCH8|MIR|RNF178
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 33kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- YNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHGYGICHSDTNSSCCTEPEDTGAEIIHV
- Uniprot:
- Q5T0T0
- Synonyme:
- c-MIR;c-mir, cellular modulator of immune recognition;Cellular modulator of immune recognition;cellular modulator of immune recognition (c-MIR);CMIR;E3 ubiquitin-protein ligase MARCH8;E3 ubiquitin-protein ligase MARCHF8;MARCH-VIII;MARCH8;membrane associated ring finger 8;membrane-associated ring finger (C3HC4) 8, E3 ubiquitin protein ligase;membrane-associated RING finger protein 8;membrane-associated RING-CH protein VIII;MIR;RING finger protein 178;RING-type E3 ubiquitin transferase MARCH8;RING-type E3 ubiquitin transferase MARCHF8;RNF178
- Weitere Details:
- MARCH8 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH8 induces the internalization of several membrane glycoproteins (Goto et al., 2003 [PubMed 12582153]; Bartee et al., 2004 [PubMed 14722266]).
- Versandbedingungen:
- Blue Ice