[KO Validated] MEK7 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A12950
Zusätzliche Namen:: JNKK2|K7|MAPKK7|MEK|MEK 7|MKK7|PRKMK7|SAPKK-4|SAPKK4
Anwendung:: ELISA, WB
Molekulargewicht:: 48 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQPHLPFFR
Uniprot:: O14733
Synonyme:: c-Jun N-terminal kinase kinase 2;dual specificity mitogen-activated protein kinase kinase 7;JNK-activating kinase 2;JNKK2;MAP kinase kinase 7;MAPK/ERK kinase 7;MAPKK7;MEK;MEK 7;MKK7;PRKMK7;SAPK kinase 4;SAPKK-4;SAPKK4;stress-activated protein kinase kinase 4
Weitere Details:: The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically activates MAPK8/JNK1 and MAPK9/JNK2, and this kinase itself is phosphorylated and activated by MAP kinase kinase kinases including MAP3K1/MEKK1, MAP3K2/MEKK2,MAP3K3/MEKK5, and MAP4K2/GCK. This kinase is involved in the signal transduction mediating the cell responses to proinflammatory cytokines, and environmental stresses. Alternative splicing results in multiple transcript variants.