A12942
[KO Validated] CDK7 Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A12942
- Zusätzliche Namen:
- CAK|CAK1|CDKN7|HCAK|K7|MO15|p39MO15|STK1
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 40kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
- Uniprot:
- P50613
- Synonyme:
- 39 KDa protein kinase;CAK;CAK1;CDK-activating kinase 1;CDKN7;cell division protein kinase 7;cyclin-dependent kinase 7;cyclin-dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk-activating kinase);HCAK;homolog of Xenopus MO15 Cdk-activating kinase;kinase subunit of CAK;MO15;p39MO15;serine/threonine kinase stk1;serine/threonine protein kinase 1;serine/threonine protein kinase MO15;Serine/threonine-protein kinase 1;STK1;TFIIH basal transcription factor complex kinase subunit
- Weitere Details:
- The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle.
- Versandbedingungen:
- Blue Ice
![[KO Validated] CDK7 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12942/A12942_1.jpg)
![[KO Validated] CDK7 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12942/A12942_2.jpg)
![[KO Validated] CDK7 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12942/A12942_3.jpg)
![[KO Validated] CDK7 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12942/A12942_Q3294_WB_01.jpg)
![[KO Validated] CDK7 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12942/A12942_Q3294_KO-WB_01.jpg)
![[KO Validated] CDK7 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12942/A12942_Q3293_IF_01.jpg)