A12934
[KO Validated] MTCH2 Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A12934
- Zusätzliche Namen:
- H2|HSPC032|MIMP|SLC25A50
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 33 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- VGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVIKETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGI
- Uniprot:
- Q9Y6C9
- Synonyme:
- 2310034D24Rik;HSPC032;met-induced mitochondrial protein;MIMP;mitochondrial carrier homolog 2;SLC25A50;solute carrier family 25, member 50
- Weitere Details:
- This gene encodes a member of the SLC25 family of nuclear-encoded transporters that are localized in the inner mitochondrial membrane. Members of this superfamily are involved in many metabolic pathways and cell functions. Genome-wide association studies in human have identified single-nucleotide polymorphisms in several loci associated with obesity. This gene is one such locus, which is highly expressed in white adipose tissue and adipocytes, and thought to play a regulatory role in adipocyte differentiation and biology. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target that can produce two isoforms from the same mRNA by use of alternative in-frame translation termination codons.
- Versandbedingungen:
- Blue Ice
![[KO Validated] MTCH2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12934/A12934_1.jpg)
![[KO Validated] MTCH2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12934/A12934_2.jpg)
![[KO Validated] MTCH2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12934/A12934_3.jpg)
![[KO Validated] MTCH2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12934/A12934_4.jpg)
![[KO Validated] MTCH2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12934/A12934_P11015_WB_01.jpg)
![[KO Validated] MTCH2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12934/A12934_P11015_KO-WB_01.jpg)
![[KO Validated] MTCH2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12934/A12934_P11015_IF_01.jpg)
![[KO Validated] MTCH2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A12934/A12934_P11015_IF_02.jpg)