[KO Validated] MTCH2 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A12934
Zusätzliche Namen:: H2|HSPC032|MIMP|SLC25A50
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 33 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVIKETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGI
Uniprot:: Q9Y6C9
Synonyme:: 2310034D24Rik;HSPC032;met-induced mitochondrial protein;MIMP;mitochondrial carrier homolog 2;SLC25A50;solute carrier family 25, member 50
Weitere Details:: This gene encodes a member of the SLC25 family of nuclear-encoded transporters that are localized in the inner mitochondrial membrane. Members of this superfamily are involved in many metabolic pathways and cell functions. Genome-wide association studies in human have identified single-nucleotide polymorphisms in several loci associated with obesity. This gene is one such locus, which is highly expressed in white adipose tissue and adipocytes, and thought to play a regulatory role in adipocyte differentiation and biology. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target that can produce two isoforms from the same mRNA by use of alternative in-frame translation termination codons.

Versandbedingungen:: Blue Ice