A12933
FUT8 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A12933
- Zusätzliche Namen:
- CDGF|CDGF1|FUT8
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 75 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- FHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTKYPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQTLHPDASANFHSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPMEPGDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVREKIETVKYPTYPEAEK
- Uniprot:
- Q9BYC5
- Synonyme:
- alpha-(1,6)-fucosyltransferase;alpha1-6FucT;CDGF;CDGF1;Fucosyltransferase 8;fucosyltransferase 8 (alpha (1,6) fucosyltransferase);GDP-fucose--glycoprotein fucosyltransferase;GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1,6-fucosyltransferase;glycoprotein 6-alpha-L-fucosyltransferase
- Weitere Details:
- This gene encodes an enzyme belonging to the family of fucosyltransferases. The product of this gene catalyzes the transfer of fucose from GDP-fucose to N-linked type complex glycopeptides. This enzyme is distinct from other fucosyltransferases which catalyze alpha1-2, alpha1-3, and alpha1-4 fucose addition. The expression of this gene may contribute to the malignancy of cancer cells and to their invasive and metastatic capabilities. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice