A12913
Clusterin alpha chain Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A12913
- Zusätzliche Namen:
- AAG4|APO-J|APOJ|CLI|CLU1|CLU2|Clusterin alpha chain|KUB1|NA1/NA2|SGP-2|SGP2|SP-40|TRPM-2|TRPM2
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 37-40kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- STNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
- Uniprot:
- P10909
- Synonyme:
- AAG4;Aging-associated gene 4 protein;aging-associated protein 4;APO-J;APOJ;apolipoprotein J;CLI;CLU1;CLU2;clusterin;complement cytolysis inhibitor;complement lysis inhibitor;complement-associated protein SP-40,40;epididymis secretory sperm binding protein;ku70-binding protein 1;KUB1;NA1/NA2;SGP-2;SGP2;SP-40;sulfated glycoprotein 2;testosterone-repressed prostate message 2;TRPM-2;TRPM2
- Weitere Details:
- The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.
- Versandbedingungen:
- Blue Ice








