CLDN4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12912
Zusätzliche Namen:: CLDN4|CPE-R|CPER|CPETR|CPETR1|hCPE-R|WBSCR8
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 18kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
Uniprot:: O14493
Synonyme:: claudin-4;Clostridium perfringens enterotoxin receptor;Clostridium perfringens enterotoxin receptor 1;CPE-R;CPE-receptor;CPER;CPETR;CPETR1;hCPE-R;WBSCR8;Williams-Beuren syndrome chromosomal region 8 protein
Weitere Details:: The protein encoded by this intronless gene belongs to the claudin family. Claudins are integral membrane proteins that are components of the epithelial cell tight junctions, which regulate movement of solutes and ions through the paracellular space. This protein is a high-affinity receptor for Clostridium perfringens enterotoxin (CPE) and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems.