AKT3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12909
Zusätzliche Namen:: AKT3|MPPH|MPPH2|PKB-GAMMA|PKBG|PRKBG|RAC-gamma|RAC-PK-gamma|STK-2
Anwendung:: ELISA, WB
Molekulargewicht:: 60kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DTPEEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEV
Uniprot:: Q9Y243
Synonyme:: MPPH;MPPH2;PKB gamma;PKB-GAMMA;PKBG;PRKBG;Protein kinase Akt-3;Protein kinase B gamma;RAC-gamma;RAC-gamma serine/threonine protein kinase;RAC-gamma serine/threonine-protein kinase;RAC-PK-gamma;STK-2;v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)
Weitere Details:: The protein encoded by this gene is a member of the AKT, also called PKB, serine/threonine protein kinase family. AKT kinases are known to be regulators of cell signaling in response to insulin and growth factors. They are involved in a wide variety of biological processes including cell proliferation, differentiation, apoptosis, tumorigenesis, as well as glycogen synthesis and glucose uptake. This kinase has been shown to be stimulated by platelet-derived growth factor (PDGF), insulin, and insulin-like growth factor 1 (IGF1). Alternatively splice transcript variants encoding distinct isoforms have been described.

Versandbedingungen:: Blue Ice