IFNL3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12908
Zusätzliche Namen:: IFN-lambda-3|IFN-lambda-4|IFNL3|IL-28B|IL-28C|IL28B|IL28C
Anwendung:: ELISA, IHC-P
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
Uniprot:: Q8IZI9
Synonyme:: cytokine Zcyto22;IFN-lambda-3;IFN-lambda-4;IL-28B;IL-28C;IL28B;IL28C;interferon lambda-3;interferon, lambda 4;interleukin-28B;interleukin-28C
Weitere Details:: This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 29 (IL29) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA).