A12896
RUFY3 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A12896
- Zusätzliche Namen:
- RIPX|RUFY3|SINGAR1|ZFYVE30
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 56kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHEDPNYLM
- Uniprot:
- Q7L099
- Synonyme:
- protein RUFY3;rap2 interacting protein x;Rap2-interacting protein x;RIPX;RUN and FYVE domain-containing protein 3;SINGAR1;single axon-regulated protein;single axon-related 1;ZFYVE30
- Weitere Details:
- This gene encodes a RPIP8, UNC-14, and NESCA domain-containing protein that is required for maintenance of neuronal polarity. In addition, it has been implicated in mediation of gastric cancer cell migration and invasion via interaction with P21-activated kinase-1, which promotes its expression. The encoded protein localizes to F-actin-enriched invadopodia to induce formation of protrusions, thereby facilitating cell migration. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice