A12889
FCER1G Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A12889
- Zusätzliche Namen:
- FCER1G|FCRG
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 12kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
- Uniprot:
- P30273
- Synonyme:
- Fc epsilon receptor Ig;Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide;Fc receptor gamma-chain;fc-epsilon RI-gamma;fceRI gamma;FCRG;fcRgamma;high affinity immunoglobulin epsilon receptor subunit gamma;IgE Fc receptor subunit gamma;immunoglobulin E receptor, high affinity, gamma chain
- Weitere Details:
- The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors.
- Versandbedingungen:
- Blue Ice