TDRD1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12882
Zusätzliche Namen:: CT41.1|TDRD1
Anwendung:: ELISA, WB
Molekulargewicht:: 132kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PFNFEKNENKLPPHESLRSPGTLPNHPNFRLKSSENGNKKNNFLLCEQTKQYLASQEDNSVSSNPNGINGEVVGSKGDRKKLPAGNSVSPPSAESNSPPKE
Uniprot:: Q9BXT4
Synonyme:: cancer/testis antigen 41.1;CT41.1;testicular tissue protein Li 193;tudor domain-containing protein 1
Weitere Details:: This gene encodes a protein containing a tudor domain that is thought to function in the suppression of transposable elements during spermatogenesis. The related protein in mouse forms a complex with piRNAs and Piwi proteins to promote methylation and silencing of target sequences. This gene was observed to be upregulated by ETS transcription factor ERG in prostate tumors.