[KO Validated] NDUFS2 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A12858
Zusätzliche Namen:: CI-49|MC1DN6|S2
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 49kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGLMDDIYQFSKNFSLRLDELEELLTNNRIWRNRTIDIGVVTAEEALNYGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR
Uniprot:: O75306
Synonyme:: CI-49;CI-49kD;complex 1, mitochondrial respiratory chain, 49-KD subunit;complex I 49kDa subunit;Complex I-49kD;MC1DN6;NADH dehydrogenase (ubiquinone) Fe-S protein 2, 49kDa (NADH-coenzyme Q reductase);NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial;NADH-ubiquinone oxidoreductase 49 kDa subunit;NADH-ubiquinone oxidoreductase NDUFS2 subunit
Weitere Details:: The protein encoded by this gene is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (complex I). Mammalian mitochondrial complex I is composed of at least 43 different subunits, 7 of which are encoded by the mitochondrial genome, and the rest are the products of nuclear genes. The iron-sulfur protein fraction of complex I is made up of 7 subunits, including this gene product. Complex I catalyzes the NADH oxidation with concomitant ubiquinone reduction and proton ejection out of the mitochondria. Mutations in this gene are associated with mitochondrial complex I deficiency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice