A12851
SULT1A2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A12851
- Zusätzliche Namen:
- HAST4|P-PST|P-PST 2|ST1A2|STP2|SULT1A2|TSPST2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 34kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
- Uniprot:
- P50226
- Synonyme:
- aryl sulfotransferase 2;arylamine sulfotransferase;HAST4;P-PST;P-PST 2;phenol sulfotransferase 2;phenol-preferring phenol sulfotransferase2;phenol-sulfating phenol sulfotransferase 2;phenolic-metabolizing (P) form of PST;ST1A2;STP2;sulfotransferase 1A2;sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2;thermostable phenol sulfotransferase;TSPST2
- Weitere Details:
- Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Two alternatively spliced variants that encode the same protein have been described.
- Versandbedingungen:
- Blue Ice

