SPOCK3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12849
Zusätzliche Namen:: HSAJ1454|SPOCK3|TES-3|TICN3
Anwendung:: ELISA, WB
Molekulargewicht:: 49kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: CPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKTLLRPERSRFDTSILPICKDSLGWMFNRLDTNYDLLLDQSELRSIYLDKNEQCTKAFFNSCDTYKDSLISNNEWCYCFQRQQDPPCQTELSNIQKRQGVKKLLGQYIPLCDEDGYYKPTQCHGSVGQCWCVDRYGNEVMGSRINGVADCAID
Uniprot:: Q9BQ16
Synonyme:: HSAJ1454;SPARC/osteonectin, cwcv and kazal like domains proteoglycan 3;sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3;SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 3;TES-3;testican-3;TICN3
Weitere Details:: This gene encodes a member of a novel family of calcium-binding proteoglycan proteins that contain thyroglobulin type-1 and Kazal-like domains. The encoded protein and may play a role in adult T-cell leukemia by inhibiting the activity of membrane-type matrix metalloproteinases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.