SLC27A1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12847
Zusätzliche Namen:: ACSVL5|FATP|FATP-1|FATP1|SLC27A1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 71kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DTFRWRGENVSTTEVEGVLSRLLGQTDVAVYGVAVPGVEGKAGMAAVADPHSLLDPNAIYQELQKVLAPYARPIFLRLLPQVDTTGTFKIQKTRLQREGFDPRQTSDRLFFLDLKQGHYLPLNEAVYTRICSGAFAL
Uniprot:: Q6PCB7
Synonyme:: ACSVL5;FATP;FATP-1;FATP1;fatty acid transport protein 1;long-chain fatty acid transport protein 1;solute carrier family 27 (fatty acid transporter), member 1;Solute carrier family 27 member 1
Weitere Details:: Enables biotin transmembrane transporter activity; efflux transmembrane transporter activity; and long-chain fatty acid transporter activity. Involved in several processes, including carboxylic acid transmembrane transport; glycerophospholipid biosynthetic process; and lipid transport across blood-brain barrier. Located in membrane. Part of plasma membrane.