A12844
PPM1J Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A12844
- Zusätzliche Namen:
- PP2C-zeta|PP2CZ|PP2Czeta|PPM1J|PPP2CZ
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 60kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- VEGRRSVTGVPREPSRGQGLCFYYWGLFDGHAGGGAAEMASRLLHRHIREQLKDLVEILQDPSPPPLCLPTTPGTPDSSDPSHLLGPQSCWSSQKEVSHESLVVGAVENAFQLMDEQMARERRGHQVEGGC
- Uniprot:
- Q5JR12
- Synonyme:
- PP2C-zeta;PP2CZ;PP2Czeta;PPP2CZ;protein phosphatase 1J;protein phosphatase 1J (PP2C domain containing);Protein phosphatase 2C isoform zeta;protein phosphatase 2C zeta
- Weitere Details:
- This gene encodes the serine/threonine protein phosphatase. The mouse homolog of this gene apparently belongs to the protein phosphatase 2C family of genes. The exact function of this gene is not yet known.
- Versandbedingungen:
- Blue Ice