A12830
CDK11B Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A12830
- Zusätzliche Namen:
- CDC2L1|CDK11|CDK11-p110|CDK11-p46|CDK11-p58|CDK11B|CLK-1|p58|p58CDC2L1|p58CLK-1|PITSLREA|PK58
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 110kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKERE
- Uniprot:
- P21127
- Synonyme:
- CDC-related protein kinase p58;CDC2L1;CDK11;CDK11-p110;CDK11-p46;CDK11-p58;cell division cycle 2-like 1 (PITSLRE proteins);Cell division cycle 2-like protein kinase 1;cell division protein kinase 11B;CLK-1;cyclin-dependent kinase 11B;galactosyltransferase-associated protein kinase p58/GTA;p58;p58 CLK-1;p58CDC2L1;p58CLK-1;PITSLRE serine/threonine-protein kinase CDC2L1;PITSLREA;PK58
- Weitere Details:
- This gene encodes a member of the serine/threonine protein kinase family. Members of this kinase family are known to be essential for eukaryotic cell cycle control. Due to a segmental duplication, this gene shares very high sequence identity with a neighboring gene. These two genes are frequently deleted or altered in neuroblastoma. The protein kinase encoded by this gene can be cleaved by caspases and may play a role in cell apoptosis. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice



