A12789
PDIA2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A12789
- Zusätzliche Namen:
- PDA2|PDI|PDIA2|PDIP|PDIR
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 58kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- FGLKAEAAPTLRLVNLETTKKYAPVDGGPVTAASITAFCHAVLNGQVKPYLLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQDHEDIIIAELDATANELDAFAVHGFPTLKYFPAGPGRKVIEYKSTRDLETFSKFLDNGGVLPTEEPPEEPAAPFPEPPANSTMGSKEEL
- Uniprot:
- Q13087
- Synonyme:
- pancreas-specific protein disulfide isomerase;pancreatic protein disulfide isomerase;PDA2;PDI;PDIP;PDIR;protein disulfide isomerase-associated 2;protein disulfide isomerase, pancreatic;protein disulfide-isomerase A2;Rho GDP dissociation inhibitor gamma
- Weitere Details:
- This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, two catalytically active thioredoxin (TRX) domains, two TRX-like domains and a C-terminal ER-retention sequence. The protein plays a role in the folding of nascent proteins in the endoplasmic reticulum by forming disulfide bonds through its thiol isomerase, oxidase, and reductase activity. The encoded protein also possesses estradiol-binding activity and can modulate intracellular estradiol levels.
- Versandbedingungen:
- Blue Ice