A12782
EBF1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A12782
- Zusätzliche Namen:
- COE1|EBF|EBF1|O/E-1|OLF1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 75kDaa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GGSPTFLNGSAANSPYAIVPSSPTMASSTSLPSNCSSSSGIFSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNSLQAISGMIVPPM
- Uniprot:
- Q9UH73
- Synonyme:
- COE1;Collier, Olf and EBF transcription factor 1;early B cell factor 1;Early B-cell factor;EBF;O/E-1;OLF1;olfactory neuronal transcription factor 1;transcription factor COE1
- Weitere Details:
- Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in positive regulation of transcription by RNA polymerase II. Predicted to act upstream of or within positive regulation of transcription, DNA-templated. Predicted to be located in nucleus. Predicted to be part of chromatin.
- Versandbedingungen:
- Blue Ice