ADIPOR2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A12777
Zusätzliche Namen:: ACDCR2|ADIPOR2|PAQR2
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 44kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETG
Uniprot:: Q86V24
Synonyme:: ACDCR2;adiponectin receptor protein 2;PAQR2;progestin and adipoQ receptor family member 2;progestin and adipoQ receptor family member II
Weitere Details:: The adiponectin receptors, ADIPOR1 (MIM 607945) and ADIPOR2, serve as receptors for globular and full-length adiponectin (MIM 605441) and mediate increased AMPK (see MIM 602739) and PPAR-alpha (PPARA; MIM 170998) ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin (Yamauchi et al., 2003 [PubMed 12802337]).