A12768
PEBP1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A12768
- Zusätzliche Namen:
- HCNP|HCNPpp|HEL-210|HEL-S-34|HEL-S-96|PBP|PEBP|PEBP-1|PEBP1|RKIP
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 21kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSG
- Uniprot:
- P30086
- Synonyme:
- epididymis luminal protein 210;epididymis secretory protein Li 34;epididymis secretory protein Li 96;HCNP;HCNPpp;HEL-210;HEL-S-34;HEL-S-96;hippocampal cholinergic neurostimulating peptide;neuropolypeptide h3;PBP;PEBP;PEBP-1;phosphatidylethanolamine-binding protein 1;prostatic binding protein;Prostatic-binding protein;raf kinase inhibitor protein;Raf kinase inhibitory protein;RKIP
- Weitere Details:
- This gene encodes a member of the phosphatidylethanolamine-binding family of proteins and has been shown to modulate multiple signaling pathways, including the MAP kinase (MAPK), NF-kappa B, and glycogen synthase kinase-3 (GSK-3) signaling pathways. The encoded protein can be further processed to form a smaller cleavage product, hippocampal cholinergic neurostimulating peptide (HCNP), which may be involved in neural development. This gene has been implicated in numerous human cancers and may act as a metastasis suppressor gene. Multiple pseudogenes of this gene have been identified in the genome.
- Versandbedingungen:
- Blue Ice