A12763
Kdm6b Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A12763
- Zusätzliche Namen:
- 1700064E03Rik|Jmjd3|Kdm6b
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 170kDa
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- ABP:
- Not Sure -> Send to PM
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LESLHGCVQALLREPAQPGLWEQLGQLYESEHDSEEAVCCYHRALRYGGSFAELGPRIGRLQQAQLWNFHAGSCQHRAKVLPPLEQVWNLLHLEHKRNYGA
- Synonyme:
- [histone H3]-trimethyl-L-lysine(27) demethylase 6B;1700064E03Rik;BC038313;jmjC domain-containing protein 3;JMJD3;jumonji domain containing 3;jumonji domain containing 3, histone lysine demethylase;jumonji domain-containing protein 3;lysine (K)-specific demethylase 6B;lysine-specific demethylase 6B;NEDCFSA
- Weitere Details:
- Enables beta-catenin binding activity; histone H3-tri/di-methyl-lysine-27 demethylase activity; and sequence-specific DNA binding activity. Involved in several processes, including histone H3-K27 demethylation; mesodermal cell differentiation; and positive regulation of cold-induced thermogenesis. Acts upstream of or within several processes, including cellular response to hydrogen peroxide; histone demethylation; and positive regulation of transcription by RNA polymerase II. Located in nucleus. Is expressed in several structures, including brain; gut; liver; metanephros; and olfactory epithelium. Orthologous to human KDM6B (lysine demethylase 6B).
- Versandbedingungen:
- Blue Ice







