A12757
SYT7 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A12757
- Zusätzliche Namen:
- IPCA-7|IPCA7|PCANAP7|SYT-VII|SYT7|SYTVII
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 47kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- CHWCQRKLGKRYKNSLETVGTPDSGRGRSEKKAIKLPAGGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGT
- Uniprot:
- O43581
- Synonyme:
- IPCA-7;IPCA7;PCANAP7;prostate cancer-associated protein 7;synaptotagmin VII;synaptotagmin-7;SYT-VII;SYTVII
- Weitere Details:
- This gene is a member of the synaptotagmin gene family and encodes a protein similar to other family members that mediate calcium-dependent regulation of membrane trafficking in synaptic transmission. A similar protein in rodents mediates hormone secretion and lysosome exocytosis. In humans, expression of this gene has been associated with prostate cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Versandbedingungen:
- Blue Ice