A12752
RAB14 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A12752
- Zusätzliche Namen:
- FBP|RAB-14|RAB14
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 24kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAK
- Uniprot:
- P61106
- Synonyme:
- bA165P4.3 (member RAS oncogene family);F protein-binding protein 1;FBP;RAB-14;ras-related protein Rab-14;small GTP binding protein RAB14
- Weitere Details:
- RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes (Junutula et al., 2004 [PubMed 15004230]).
- Versandbedingungen:
- Blue Ice



