A12732
LSM1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A12732
- Zusätzliche Namen:
- CASM|LSM1|YJL124C
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 17kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY
- Uniprot:
- O15116
- Synonyme:
- cancer-associated Sm protein;Cancer-associated Sm-like;cancer-associated Sm-like protein;CASM;LSM1 homolog, U6 small nuclear RNA associated;LSM1 mRNA degradation associated;LSM1-like protein U6 small nuclear RNA associated;LSM1, U6 small nuclear RNA associated;small nuclear ribonuclear CaSm;U6 snRNA-associated Sm-like protein LSm1;YJL124C
- Weitere Details:
- This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Increased expression of this gene may play a role in cellular transformation and the progression of several malignancies including lung cancer, mesothelioma and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9.
- Versandbedingungen:
- Blue Ice